SPACA1 antibody - N-terminal region (ARP49984_P050)
Data Sheet
 
Product Number ARP49984_P050
Product Page www.avivasysbio.com/spaca1-antibody-n-terminal-region-arp49984-p050.html
Product Name SPACA1 antibody - N-terminal region (ARP49984_P050)
Size 100 ul
Gene Symbol SPACA1
Alias Symbols MGC32952, SAMP32
Protein Size (# AA) 294 amino acids
Molecular Weight 32kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 81833
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Sperm acrosome associated 1
Description This is a rabbit polyclonal antibody against SPACA1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: TENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNG
Description of Target The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from infertile males. Furthermore, antibodies generated against the recombinant protein block in vitro fertilization. This protein localizes to the acrosomal membrane of spermatids and mature spermatozoa where it is thought to play a role in acrosomal morphogenesis and in sperm-egg binding and fusion, respectively.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-SPACA1 (ARP49984_P050) antibody is Catalog # AAP49984 (Previous Catalog # AAPP44260)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SPACA1
Complete computational species homology data Anti-SPACA1 (ARP49984_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express SPACA1.
Swissprot Id Q9HBV2
Protein Name Sperm acrosome membrane-associated protein 1
Sample Type Confirmation

SPACA1 is supported by BioGPS gene expression data to be expressed in NCIH226

Protein Accession # NP_112222
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express SPACA1.
Nucleotide Accession # NM_030960
Replacement Item This antibody may replace item sc-244192 from Santa Cruz Biotechnology.
Conjugation Options

ARP49984_P050-FITC Conjugated

ARP49984_P050-HRP Conjugated

ARP49984_P050-Biotin Conjugated

CB Replacement sc-244192
Tested Species Reactivity Human
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human NCI-H226
WB Suggested Anti-SPACA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysateSPACA1 is supported by BioGPS gene expression data to be expressed in NCIH226
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com