| Product Number |
ARP49984_P050 |
| Product Page |
www.avivasysbio.com/spaca1-antibody-n-terminal-region-arp49984-p050.html |
| Name |
SPACA1 Antibody - N-terminal region (ARP49984_P050) |
| Protein Size (# AA) |
294 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
81833 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sperm acrosome associated 1 |
| Alias Symbols |
SAMP32 |
| Peptide Sequence |
Synthetic peptide located within the following region: TENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from infertile males. Furthermore, antibodies generated against the recombinant protein block in vitro fertilization. This protein localizes to the acrosomal membrane of spermatids and mature spermatozoa where it is thought to play a role in acrosomal morphogenesis and in sperm-egg binding and fusion, respectively. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SPACA1 (ARP49984_P050) antibody |
| Blocking Peptide |
For anti-SPACA1 (ARP49984_P050) antibody is Catalog # AAP49984 (Previous Catalog # AAPP44260) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SPACA1 |
| Uniprot ID |
Q9HBV2 |
| Protein Name |
Sperm acrosome membrane-associated protein 1 |
| Sample Type Confirmation |
SPACA1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
| Protein Accession # |
NP_112222 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_030960 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SPACA1 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human NCI-H226
 | WB Suggested Anti-SPACA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysateSPACA1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
|
