REEP4 Antibody - N-terminal region (ARP49944_P050)

• Name: REEP4 Antibody - N-terminal region (ARP49944_P050)
• Protein Size (# AA): 257 amino acids
• Molecular Weight: 29kDa
• NCBI Gene Id: 80346
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Receptor accessory protein 4
• Alias Symbols: PP432, Yip2c, C8orf20
• Peptide Sequence: Synthetic peptide located within the following region: EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Description of Target: REEP4 belongs to the DP1 family. It may enhance the cell surface expression of odorant receptors.
• Protein Interactions: YWHAB; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-REEP4 (ARP49944_P050) antibody is Catalog # AAP49944 (Previous Catalog # AAPY02777)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human REEP4
• Uniprot ID: Q9H6H4
• Protein Name: Receptor expression-enhancing protein 4
• Protein Accession #: NP_079508
• Purification: Affinity Purified
• Nucleotide Accession #: NM_025232
• Tested Species Reactivity: Human
• Gene Symbol: REEP4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-REEP4 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate