Product Number |
ARP49932_P050 |
Product Page |
www.avivasysbio.com/plxna2-antibody-n-terminal-region-arp49932-p050.html |
Name |
PLXNA2 Antibody - N-terminal region (ARP49932_P050) |
Protein Size (# AA) |
1894 amino acids |
Molecular Weight |
211kDa |
NCBI Gene Id |
5362 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Plexin A2 |
Alias Symbols |
OCT, PLXN2 |
Peptide Sequence |
Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Budel,S., Schizophr. Res. 99 (1-3), 365-366 (2008) |
Description of Target |
PLXNA2 is a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. |
Protein Interactions |
CEMIP; FNBP4; UBAP2L; IFT80; HACE1; DHX37; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PLXNA2 (ARP49932_P050) antibody |
Blocking Peptide |
For anti-PLXNA2 (ARP49932_P050) antibody is Catalog # AAP49932 (Previous Catalog # AAPP29580) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PLXNA2 |
Uniprot ID |
O75051 |
Protein Name |
Plexin-A2 |
Protein Accession # |
NP_079455 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_025179 |
Tested Species Reactivity |
Human |
Gene Symbol |
PLXNA2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human HeLa
| WB Suggested Anti-PLXNA2 Antibody Titration: 0.2-1 ug/ml Positive Control: Hela cell lysate |
|
|