PLXNA2 Antibody - N-terminal region (ARP49932_P050)

Data Sheet
 
Product Number ARP49932_P050
Product Page www.avivasysbio.com/plxna2-antibody-n-terminal-region-arp49932-p050.html
Name PLXNA2 Antibody - N-terminal region (ARP49932_P050)
Protein Size (# AA) 1894 amino acids
Molecular Weight 211kDa
NCBI Gene Id 5362
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Plexin A2
Alias Symbols OCT, PLXN2
Peptide Sequence Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Budel,S., Schizophr. Res. 99 (1-3), 365-366 (2008)
Description of Target PLXNA2 is a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C.
Protein Interactions CEMIP; FNBP4; UBAP2L; IFT80; HACE1; DHX37;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PLXNA2 (ARP49932_P050) antibody
Blocking Peptide For anti-PLXNA2 (ARP49932_P050) antibody is Catalog # AAP49932 (Previous Catalog # AAPP29580)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PLXNA2
Uniprot ID O75051
Protein Name Plexin-A2
Protein Accession # NP_079455
Purification Affinity Purified
Nucleotide Accession # NM_025179
Tested Species Reactivity Human
Gene Symbol PLXNA2
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human HeLa
WB Suggested Anti-PLXNA2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com