ELOVL7 Antibody - N-terminal region (ARP49908_T100)

• Product Number: ARP49908_T100
• Name: ELOVL7 Antibody - N-terminal region (ARP49908_T100)
• Protein Size (# AA): 281 amino acids
• Molecular Weight: 33 kDa
• NCBI Gene Id: 79993
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: ELOVL fatty acid elongase 7
• Alias Symbols: FLJ23563
• Peptide Sequence: Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65
• Description of Target: ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.
• Protein Interactions: DTNBP1; CERS2; ILF3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-ELOVL7 (ARP49908_T100) antibody is Catalog # AAP49908 (Previous Catalog # AAPP29558)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL7
• Uniprot ID: A1L3X0
• Protein Name: Elongation of very long chain fatty acids protein 7
• Protein Accession #: NP_079206
• Purification: Protein A purified
• Nucleotide Accession #: NM_024930
• Tested Species Reactivity: Human
• Gene Symbol: ELOVL7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
• Image 1: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.