Product Number |
ARP49784_P050 |
Product Page |
www.avivasysbio.com/dlk2-antibody-c-terminal-region-arp49784-p050.html |
Name |
Dlk2 Antibody - C-terminal region (ARP49784_P050) |
Protein Size (# AA) |
425 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
106565 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
delta-like 2 homolog (Drosophila) |
Alias Symbols |
Egfl, DLK-2, Egfl9, AI413481 |
Peptide Sequence |
Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
Dlk2 regulates adipogenesis. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Dlk2 (ARP49784_P050) antibody |
Blocking Peptide |
For anti-Dlk2 (ARP49784_P050) antibody is Catalog # AAP49784 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dlk2 |
Uniprot ID |
Q8K1E3-3 |
Protein Name |
Protein delta homolog 2 |
Publications |
Therapeutic efficacy of combined vaccination against tumor pericyte-associated antigens DLK1 and DLK2 in mice. Oncoimmunology. 6, e1290035 (2017). 28405524 |
Protein Accession # |
NP_997549 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_207666 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Dlk2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 93% |
Image 1 | Mouse Thymus
| Host: Rabbit Target Name: Dlk2 Sample Type: Mouse Thymus lysates Antibody Dilution: 1.0ug/ml |
|
|