Dlk2 Antibody - C-terminal region (ARP49784_P050)

Data Sheet
 
Product Number ARP49784_P050
Product Page www.avivasysbio.com/dlk2-antibody-c-terminal-region-arp49784-p050.html
Name Dlk2 Antibody - C-terminal region (ARP49784_P050)
Protein Size (# AA) 425 amino acids
Molecular Weight 45kDa
NCBI Gene Id 106565
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name delta-like 2 homolog (Drosophila)
Alias Symbols Egfl, DLK-2, Egfl9, AI413481
Peptide Sequence Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Dlk2 regulates adipogenesis.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Dlk2 (ARP49784_P050) antibody
Blocking Peptide For anti-Dlk2 (ARP49784_P050) antibody is Catalog # AAP49784
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dlk2
Uniprot ID Q8K1E3-3
Protein Name Protein delta homolog 2
Publications

Therapeutic efficacy of combined vaccination against tumor pericyte-associated antigens DLK1 and DLK2 in mice. Oncoimmunology. 6, e1290035 (2017). 28405524

Protein Accession # NP_997549
Purification Affinity Purified
Nucleotide Accession # NM_207666
Tested Species Reactivity Mouse
Gene Symbol Dlk2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Image 1
Mouse Thymus
Host: Rabbit
Target Name: Dlk2
Sample Type: Mouse Thymus lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com