ACSL4 Antibody - N-terminal region (ARP49774_P050)

• Name: ACSL4 Antibody - N-terminal region (ARP49774_P050)
• Protein Size (# AA): 670 amino acids
• Molecular Weight: 79 kDa
• NCBI Gene Id: 2182
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Acyl-CoA synthetase long-chain family member 4
• Alias Symbols: ACS4, FACL4, LACS4, MRX63, MRX68
• Peptide Sequence: Synthetic peptide located within the following region: AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hu,C., (2008) Cancer Biol. Ther. 7 (1), 131-134
• Description of Target: ACSL4 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.
• Protein Interactions: UBC; TUBGCP3; TP53; SUMO2; HECW2; YWHAQ; PARK2; DSE; ACSL3; APP; UBD; ELAVL1; MINOS1; SPG20;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-ACSL4 (ARP49774_P050) antibody is Catalog # AAP49774 (Previous Catalog # AAPS27502)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACSL4
• Uniprot ID: O60488
• Protein Name: Long-chain-fatty-acid--CoA ligase 4
• Protein Accession #: NP_004449
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004458
• Tested Species Reactivity: Human
• Gene Symbol: ACSL4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human HeLa
  
  WB Suggested Anti-ACSL4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Hela cell lysate