TMEM135 Antibody - N-terminal region (ARP49773_P050)

Data Sheet
 
Product Number ARP49773_P050
Product Page www.avivasysbio.com/tmem135-antibody-n-terminal-region-arp49773-p050.html
Name TMEM135 Antibody - N-terminal region (ARP49773_P050)
Protein Size (# AA) 458 amino acids
Molecular Weight 52kDa
NCBI Gene Id 65084
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transmembrane protein 135
Alias Symbols PMP52
Peptide Sequence Synthetic peptide located within the following region: SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Description of Target The exact function of TMEM135 remains unknown.
Protein Interactions UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMEM135 (ARP49773_P050) antibody
Blocking Peptide For anti-TMEM135 (ARP49773_P050) antibody is Catalog # AAP49773 (Previous Catalog # AAPP29349)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM135
Uniprot ID Q86UB9
Protein Name Transmembrane protein 135
Publications

Mouse Tmem135 mutation reveals a mechanism involving mitochondrial dynamics that leads to age-dependent retinal pathologies. Elife. 5, (2016). 27863209

Protein Accession # NP_075069
Purification Affinity Purified
Nucleotide Accession # NM_022918
Tested Species Reactivity Human
Gene Symbol TMEM135
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86%
Image 1
Human Brain
WB Suggested Anti-TMEM135 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
Image 2
Human Bronchial Epithelial Tissue
TMEM135 antibody - N-terminal region (ARP49773_P050)
Catalog Number: ARP49773_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Membrane of bronchial epithelial tissue
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com