Product Number |
ARP49773_P050 |
Product Page |
www.avivasysbio.com/tmem135-antibody-n-terminal-region-arp49773-p050.html |
Name |
TMEM135 Antibody - N-terminal region (ARP49773_P050) |
Protein Size (# AA) |
458 amino acids |
Molecular Weight |
52kDa |
NCBI Gene Id |
65084 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transmembrane protein 135 |
Alias Symbols |
PMP52 |
Peptide Sequence |
Synthetic peptide located within the following region: SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Suzuki,Y., Gene 200 (1-2), 149-156 (1997) |
Description of Target |
The exact function of TMEM135 remains unknown. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMEM135 (ARP49773_P050) antibody |
Blocking Peptide |
For anti-TMEM135 (ARP49773_P050) antibody is Catalog # AAP49773 (Previous Catalog # AAPP29349) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM135 |
Uniprot ID |
Q86UB9 |
Protein Name |
Transmembrane protein 135 |
Publications |
Mouse Tmem135 mutation reveals a mechanism involving mitochondrial dynamics that leads to age-dependent retinal pathologies. Elife. 5, (2016). 27863209 |
Protein Accession # |
NP_075069 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022918 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMEM135 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 86% |
Image 1 | Human Brain
| WB Suggested Anti-TMEM135 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human brain |
|
Image 2 | Human Bronchial Epithelial Tissue
| TMEM135 antibody - N-terminal region (ARP49773_P050)
Catalog Number: ARP49773_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Membrane of bronchial epithelial tissue
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|