Porcn Antibody - middle region (ARP49763_P050)

• Product Number: ARP49763_P050
• Name: Porcn Antibody - middle region (ARP49763_P050)
• Protein Size (# AA): 450 amino acids
• Molecular Weight: 52 kDa
• NCBI Gene Id: 53627
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Porcupine homolog (Drosophila)
• Alias Symbols: p, Mp, Ppn, Mg61, porc, Mporc, mMg61, AW045557, DXHXS7465, DXHXS7465e, 2410004O13Rik
• Peptide Sequence: Synthetic peptide located within the following region: VAMKAVSLGFDLDRGEVGAVPSPVEFMGYLYFVGTIVFGPWISFHSYLQA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Porcn modulates the processing of Wnt proteins. Probable protein-cysteine N-palmitoyltransferase that palmitoylates Wnt family members.
• Protein Interactions: Wnt7b; Wnt7a; Wnt6; Wnt5b; Wnt5a; Wnt4; Wnt3a; Wnt3; Wnt1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Porcn (ARP49763_P050) antibody is Catalog # AAP49763 (Previous Catalog # AAPP29340)
• Uniprot ID: Q9JJJ7-4
• Protein Name: Protein-cysteine N-palmitoyltransferase porcupine
• Protein Accession #: NP_058609
• Purification: Affinity Purified
• Nucleotide Accession #: NM_016913
• Tested Species Reactivity: Mouse
• Gene Symbol: Porcn
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Mouse Thymus
  
  WB Suggested Anti-Porcn Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Thymus
• Image 2:
  
  25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.