| Product Number |
ARP49759_P050 |
| Product Page |
www.avivasysbio.com/elovl1-antibody-n-terminal-region-arp49759-p050.html |
| Name |
ELOVL1 Antibody - N-terminal region (ARP49759_P050) |
| Protein Size (# AA) |
279 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
64834 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
ELOVL fatty acid elongase 1 |
| Description |
|
| Alias Symbols |
Ssc1, IKSHD, CGI-88 |
| Peptide Sequence |
Synthetic peptide located within the following region: RGFMIVYNFSLVALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Interactions |
UBC; HSD17B12; CERS2; TECR; GLP1R; TWF2; PSMD10; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ELOVL1 (ARP49759_P050) antibody |
| Blocking Peptide |
For anti-ELOVL1 (ARP49759_P050) antibody is Catalog # AAP49759 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ELOV1 |
| Uniprot ID |
Q9BW60 |
| Protein Name |
elongation of very long chain fatty acids protein 1 |
| Publications |
Disrupted sphingolipid metabolism following acute clozapine and olanzapine administration. J Biomed Sci. 25, 40 (2018). 29720183 |
| Protein Accession # |
NP_073732 |
| Purification |
Affinity purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ELOVL1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human Stomach Tumor
 | Host: Rabbit
Target Name: ELOV1
Sample Type: Stomach Tumor lysates
Antibody Dilution: 1.0ug/ml |
|
|
