| Product Number |
ARP49757_P050 |
| Product Page |
www.avivasysbio.com/cyp3a43-antibody-middle-region-arp49757-p050.html |
| Name |
CYP3A43 Antibody - middle region (ARP49757_P050) |
| Protein Size (# AA) |
504 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
64816 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cytochrome P450, family 3, subfamily A, polypeptide 43 |
| Alias Symbols |
MGC119315, MGC119316 |
| Peptide Sequence |
Synthetic peptide located within the following region: ERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKALSDLELVAQSIIII |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Thompson,E.E., (2006) Pharmacogenomics J. 6 (2), 105-114 |
| Description of Target |
CYP3A43 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme has a low level of testosterone hydroxylase activity. Although it bears homology to some drug-metabolizing cytochrome P450s, it is unknown whether the enzyme is also involved in xenobiotic metabolism. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Alternate splicing of this gene results in three transcript variants encoding different isoforms. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CYP3A43 (ARP49757_P050) antibody |
| Blocking Peptide |
For anti-CYP3A43 (ARP49757_P050) antibody is Catalog # AAP49757 (Previous Catalog # AAPP29337) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CYP3A43 |
| Uniprot ID |
Q9HB55 |
| Protein Name |
Cytochrome P450 3A43 |
| Protein Accession # |
NP_073731 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022820 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CYP3A43 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Rabbit: 79%; Rat: 79%; Sheep: 79% |
| Image 1 | Human Liver Tissue
 | CYP3A43 antibody - middle region (ARP49757_P050)
Catalog Number: ARP49757_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in Kupffer cells of liver
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
| | Image 2 | Human Brain
 | WB Suggested Anti-CYP3A43 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain |
|
|
