ARV1 Antibody - middle region (ARP49756_P050)

• Product Number: ARP49756_P050
• Name: ARV1 Antibody - middle region (ARP49756_P050)
• Protein Size (# AA): 271 amino acids
• Molecular Weight: 31kDa
• NCBI Gene Id: 64801
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ARV1 homolog (S. cerevisiae)
• Description:
  View product citations for ARV1 Antibody - middle region (ARP49756_P050) on CiteAb
• Alias Symbols: DEE38, EIEE38
• Peptide Sequence: Synthetic peptide located within the following region: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Description of Target: ARV1 may act as a mediator of sterol homeostasis.
• Protein Interactions: UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ARV1 (ARP49756_P050) antibody is Catalog # AAP49756 (Previous Catalog # AAPP29336)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARV1
• Uniprot ID: Q9H2C2
• Protein Name: Protein ARV1
• Publications:

  Neuronal deficiency of ARV1 causes an autosomal recessive epileptic encephalopathy. Hum Mol Genet. 25, 3042-3054 (2016). 27270415

• Protein Accession #: NP_073623
• Purification: Affinity Purified
• Nucleotide Accession #: NM_022786
• Tested Species Reactivity: Human
• Gene Symbol: ARV1
• Predicted Species Reactivity: Human, Cow, Dog, Goat, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 79%; Goat: 85%; Human: 100%; Pig: 85%; Rabbit: 79%
• Image 1: Human OVCAR-3
  
  WB Suggested Anti-ARV1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: OVCAR-3 cell lysate