Product Number |
ARP49703_P050-FITC |
Product Page |
www.avivasysbio.com/xylt2-antibody-c-terminal-region-fitc-arp49703-p050-fitc.html |
Name |
XYLT2 Antibody - C-terminal region : FITC (ARP49703_P050-FITC) |
Protein Size (# AA) |
865 amino acids |
Molecular Weight |
97kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
64132 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Xylosyltransferase II |
Alias Symbols |
SOS, XT2, XT-II, PXYLT2, xylT-II |
Peptide Sequence |
Synthetic peptide located within the following region: LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
Casanova,J.C., (2008) Biochem. Biophys. Res. Commun. 365 (4), 678-684 |
Description of Target |
XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.The protein encoded by this gene is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-XYLT2 (ARP49703_P050-FITC) antibody |
Blocking Peptide |
For anti-XYLT2 (ARP49703_P050-FITC) antibody is Catalog # AAP49703 (Previous Catalog # AAPP29284) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human XYLT2 |
Uniprot ID |
Q9H1B5 |
Protein Name |
Xylosyltransferase 2 |
Protein Accession # |
NP_071450 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022167 |
Gene Symbol |
XYLT2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | |
|