Product Number |
ARP49703_P050 |
Product Page |
www.avivasysbio.com/xylt2-antibody-c-terminal-region-arp49703-p050.html |
Name |
XYLT2 Antibody - C-terminal region (ARP49703_P050) |
Protein Size (# AA) |
865 amino acids |
Molecular Weight |
97 kDa |
NCBI Gene Id |
64132 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Xylosyltransferase II |
Alias Symbols |
SOS, XT2, XT-II, PXYLT2, xylT-II |
Peptide Sequence |
Synthetic peptide located within the following region: LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Casanova,J.C., (2008) Biochem. Biophys. Res. Commun. 365 (4), 678-684 |
Description of Target |
XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.The protein encoded by this gene is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-XYLT2 (ARP49703_P050) antibody |
Blocking Peptide |
For anti-XYLT2 (ARP49703_P050) antibody is Catalog # AAP49703 (Previous Catalog # AAPP29284) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human XYLT2 |
Uniprot ID |
Q9H1B5 |
Protein Name |
Xylosyltransferase 2 |
Protein Accession # |
NP_071450 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022167 |
Tested Species Reactivity |
Human |
Gene Symbol |
XYLT2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Muscle
| WB Suggested Anti-XYLT2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|
Image 2 |
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. The peptide sequence is present in a ~71 kDa isoform. The protein may be modified by glycosylation.
|
|