ELOVL5 Antibody - N-terminal region (ARP49667_P050)

• Product Number: ARP49667_P050
• Name: ELOVL5 Antibody - N-terminal region (ARP49667_P050)
• Protein Size (# AA): 299 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 60481
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ELOVL fatty acid elongase 5
• Alias Symbols: HELO1, SCA38, dJ483K16.1
• Peptide Sequence: Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Barragan,I., (2005) Int. J. Mol. Med. 16 (6), 1163-1167
• Description of Target: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011
• Protein Interactions: UBC; CERS2; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ELOVL5 (ARP49667_P050) antibody is Catalog # AAP49667 (Previous Catalog # AAPP29250)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5
• Uniprot ID: Q9NYP7
• Protein Name: Elongation of very long chain fatty acids protein 5
• Sample Type Confirmation:

  ELOVL5 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

  There is BioGPS gene expression data showing that ELOVL5 is expressed in MCF7

• Protein Accession #: NP_068586
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021814
• Tested Species Reactivity: Human
• Gene Symbol: ELOVL5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 93%; Goat: 92%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 93%
• Image 1: 293T Cell Lysate, Human Ovary Tumor
  
  Host: Rabbit
  Target: ELOVL5
  Positive control (+): 293T Cell Lysate (2T)
  Negative control (-): Human Ovary Tumor (T-OV)
  Antibody concentration: 0.2ug/ml
• Image 2: Human Jurkat
  
  Host: Rabbit
  Target Name: ELOVL5
  Sample Tissue: Human Jurkat
  Antibody Dilution: 1.0ug/ml