| Product Number |
ARP49648_P050 |
| Product Page |
www.avivasysbio.com/cdh22-antibody-n-terminal-region-arp49648-p050.html |
| Name |
CDH22 Antibody - N-terminal region (ARP49648_P050) |
| Protein Size (# AA) |
828 amino acids |
| Molecular Weight |
89 kDa |
| NCBI Gene Id |
64405 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cadherin 22, type 2 |
| Description |
|
| Alias Symbols |
C20orf25, dJ998H6.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
CDH22 is a member of the cadherin superfamily. CDH22 is composed of five cadherin repeat domains and a cytoplasmic tail similar to the highly conserved cytoplasmic region of classical cadherins. |
| Protein Interactions |
UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
|
| Datasheets/Manuals |
Printable datasheet for anti-CDH22 (ARP49648_P050) antibody |
| Blocking Peptide |
For anti-CDH22 (ARP49648_P050) antibody is Catalog # AAP49648 |
| Uniprot ID |
Q61751 |
| Protein Name |
Zinc finger protein 354A |
| Publications |
Hypoxia activates cadherin-22 synthesis via eIF4E2 to drive cancer cell migration, invasion and adhesion. Oncogene. 37, 651-662 (2018). 28991229 |
| Protein Accession # |
NP_033355 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009329 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CDH22 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91% |
| Image 1 | Human HeLa
 | WB Suggested Anti-CDH22 Antibody
Titration: 1.0 ug/ml
Positive Control: Hela Whole Cell |
|
|
