| Product Number |
ARP49645_P050-FITC |
| Product Page |
www.avivasysbio.com/ntn4-antibody-n-terminal-region-fitc-arp49645-p050-fitc.html |
| Name |
NTN4 Antibody - N-terminal region : FITC (ARP49645_P050-FITC) |
| Protein Size (# AA) |
628 amino acids |
| Molecular Weight |
70kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
59277 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Netrin 4 |
| Alias Symbols |
PRO3091 |
| Peptide Sequence |
Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Esseghir,S., (2007) Clin. Cancer Res. 13 (11), 3164-3173 |
| Description of Target |
NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants. NTN4 belongs to a family of proteins related to laminins (see LAMA1, MIM 150320) Koch et al. (2000) [PubMed 11038171].[supplied by OMIM]. |
| Protein Interactions |
KRTAP5-9; CDKN1A; ADAMTSL4; PLSCR1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-NTN4 (ARP49645_P050-FITC) antibody |
| Blocking Peptide |
For anti-NTN4 (ARP49645_P050-FITC) antibody is Catalog # AAP49645 (Previous Catalog # AAPP29491) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NTN4 |
| Uniprot ID |
Q9HB63 |
| Protein Name |
Netrin-4 |
| Protein Accession # |
NP_067052 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_021229 |
| Gene Symbol |
NTN4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | |
|
