| Product Number |
ARP49612_P050 |
| Product Page |
www.avivasysbio.com/nmb-antibody-n-terminal-region-arp49612-p050.html |
| Name |
NMB Antibody - N-terminal region (ARP49612_P050) |
| Protein Size (# AA) |
121 amino acids |
| Molecular Weight |
13kDa |
| NCBI Gene Id |
4828 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
neuromedin B |
| Alias Symbols |
NMB, |
| Peptide Sequence |
Synthetic peptide located within the following region: KIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
NMB stimulates smooth muscle contraction in a manner similar to that of bombesin. |
| Protein Interactions |
BIRC2; Dlg4; TPP1; NMBR; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NMB (ARP49612_P050) antibody |
| Blocking Peptide |
For anti-NMB (ARP49612_P050) antibody is Catalog # AAP49612 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NMB |
| Uniprot ID |
P08949 |
| Protein Name |
Neuromedin-B |
| Purification |
Affinity Purified |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NMB |
| Predicted Species Reactivity |
Human, Cow, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Guinea Pig: 86%; Human: 100%; Rabbit: 79% |
| Image 1 | Human Stomach Tumor
 | Host: Rabbit
Target Name: NMB
Sample Type: Stomach Tumor lysates
Antibody Dilution: 1.0ug/ml |
|
|
