Product Number |
ARP49593_P050-HRP |
Product Page |
www.avivasysbio.com/lrrc4c-antibody-n-terminal-region-hrp-arp49593-p050-hrp.html |
Name |
LRRC4C Antibody - N-terminal region : HRP (ARP49593_P050-HRP) |
Protein Size (# AA) |
640 amino acids |
Molecular Weight |
72kDa |
Conjugation |
HRP: Horseradish Peroxidase |
NCBI Gene Id |
57689 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Leucine rich repeat containing 4C |
Alias Symbols |
NGL1, NGL-1 |
Peptide Sequence |
Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE |
Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Reference |
Lin,J.C., (2003) Nat. Neurosci. 6 (12), 1270-1276 |
Description of Target |
NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 AB046800.1 1-528 529-1824 AB046800.1 530-1825 1825-1827 BC041374.2 840-842 1828-1922 BC041374.2 844-938 1923-2926 BC041374.2 992-1995 2927-4054 AB046800.1 2928-4055 |
Protein Interactions |
CREB3L4; NTNG1; LRRC4C; DFNB31; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-LRRC4C (ARP49593_P050-HRP) antibody |
Blocking Peptide |
For anti-LRRC4C (ARP49593_P050-HRP) antibody is Catalog # AAP49593 (Previous Catalog # AAPP29442) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC4C |
Uniprot ID |
Q9HCJ2 |
Protein Name |
Leucine-rich repeat-containing protein 4C |
Protein Accession # |
NP_065980 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020929 |
Gene Symbol |
LRRC4C |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Image 1 | |
|