LRRC4C Antibody - N-terminal region : HRP (ARP49593_P050-HRP)

Data Sheet
 
Product Number ARP49593_P050-HRP
Product Page www.avivasysbio.com/lrrc4c-antibody-n-terminal-region-hrp-arp49593-p050-hrp.html
Name LRRC4C Antibody - N-terminal region : HRP (ARP49593_P050-HRP)
Protein Size (# AA) 640 amino acids
Molecular Weight 72kDa
Conjugation HRP: Horseradish Peroxidase
NCBI Gene Id 57689
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Leucine rich repeat containing 4C
Alias Symbols NGL1, NGL-1
Peptide Sequence Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reference Lin,J.C., (2003) Nat. Neurosci. 6 (12), 1270-1276
Description of Target NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 AB046800.1 1-528 529-1824 AB046800.1 530-1825 1825-1827 BC041374.2 840-842 1828-1922 BC041374.2 844-938 1923-2926 BC041374.2 992-1995 2927-4054 AB046800.1 2928-4055
Protein Interactions CREB3L4; NTNG1; LRRC4C; DFNB31;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-LRRC4C (ARP49593_P050-HRP) antibody
Blocking Peptide For anti-LRRC4C (ARP49593_P050-HRP) antibody is Catalog # AAP49593 (Previous Catalog # AAPP29442)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC4C
Uniprot ID Q9HCJ2
Protein Name Leucine-rich repeat-containing protein 4C
Protein Accession # NP_065980
Purification Affinity Purified
Nucleotide Accession # NM_020929
Gene Symbol LRRC4C
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com