LRRC4C Antibody - N-terminal region (ARP49593_P050)

Data Sheet
 
Product Number ARP49593_P050
Product Page www.avivasysbio.com/lrrc4c-antibody-n-terminal-region-arp49593-p050.html
Name LRRC4C Antibody - N-terminal region (ARP49593_P050)
Protein Size (# AA) 640 amino acids
Molecular Weight 72kDa
NCBI Gene Id 57689
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Leucine rich repeat containing 4C
Alias Symbols NGL1, NGL-1
Peptide Sequence Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lin,J.C., (2003) Nat. Neurosci. 6 (12), 1270-1276
Description of Target NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 AB046800.1 1-528 529-1824 AB046800.1 530-1825 1825-1827 BC041374.2 840-842 1828-1922 BC041374.2 844-938 1923-2926 BC041374.2 992-1995 2927-4054 AB046800.1 2928-4055
Protein Interactions CREB3L4; NTNG1; LRRC4C; DFNB31;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LRRC4C (ARP49593_P050) antibody
Blocking Peptide For anti-LRRC4C (ARP49593_P050) antibody is Catalog # AAP49593 (Previous Catalog # AAPP29442)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC4C
Uniprot ID Q9HCJ2
Protein Name Leucine-rich repeat-containing protein 4C
Protein Accession # NP_065980
Purification Affinity Purified
Nucleotide Accession # NM_020929
Tested Species Reactivity Human
Gene Symbol LRRC4C
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human 293T
WB Suggested Anti-LRRC4C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com