Product Number |
ARP49593_P050 |
Product Page |
www.avivasysbio.com/lrrc4c-antibody-n-terminal-region-arp49593-p050.html |
Name |
LRRC4C Antibody - N-terminal region (ARP49593_P050) |
Protein Size (# AA) |
640 amino acids |
Molecular Weight |
72kDa |
NCBI Gene Id |
57689 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Leucine rich repeat containing 4C |
Alias Symbols |
NGL1, NGL-1 |
Peptide Sequence |
Synthetic peptide located within the following region: LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lin,J.C., (2003) Nat. Neurosci. 6 (12), 1270-1276 |
Description of Target |
NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-528 AB046800.1 1-528 529-1824 AB046800.1 530-1825 1825-1827 BC041374.2 840-842 1828-1922 BC041374.2 844-938 1923-2926 BC041374.2 992-1995 2927-4054 AB046800.1 2928-4055 |
Protein Interactions |
CREB3L4; NTNG1; LRRC4C; DFNB31; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LRRC4C (ARP49593_P050) antibody |
Blocking Peptide |
For anti-LRRC4C (ARP49593_P050) antibody is Catalog # AAP49593 (Previous Catalog # AAPP29442) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC4C |
Uniprot ID |
Q9HCJ2 |
Protein Name |
Leucine-rich repeat-containing protein 4C |
Protein Accession # |
NP_065980 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020929 |
Tested Species Reactivity |
Human |
Gene Symbol |
LRRC4C |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human 293T
| WB Suggested Anti-LRRC4C Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: 293T cell lysate |
|
|