Product Number |
ARP49583_P050 |
Product Page |
www.avivasysbio.com/sema6d-antibody-n-terminal-region-arp49583-p050.html |
Name |
SEMA6D Antibody - N-terminal region (ARP49583_P050) |
Protein Size (# AA) |
476 amino acids |
Molecular Weight |
52kDa |
NCBI Gene Id |
80031 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D |
Alias Symbols |
FLJ11598, KIAA1479 |
Peptide Sequence |
Synthetic peptide located within the following region: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Toyofuku,T., (2004) Genes Dev. 18 (4), 435-447 |
Description of Target |
Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner. |
Protein Interactions |
PLXNA1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SEMA6D (ARP49583_P050) antibody |
Blocking Peptide |
For anti-SEMA6D (ARP49583_P050) antibody is Catalog # AAP49583 (Previous Catalog # AAPP13108) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SEMA6D |
Uniprot ID |
Q8NFY4 |
Protein Name |
Semaphorin-6D |
Protein Accession # |
NP_079242 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024966 |
Tested Species Reactivity |
Human |
Gene Symbol |
SEMA6D |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human HeLa
| WB Suggested Anti-SEMA6D Antibody Titration: 0.2-1 ug/ml Positive Control: Hela cell lysate |
|
Image 2 | Human Adult Placenta
| Host: Rabbit Target Name: SEMA6D Sample Type: Human Adult Placenta Antibody Dilution: 1.0ug/ml |
|
Image 3 | Human Fetal Heart
| Host: Rabbit Target Name: SEMA6D Sample Type: Human Fetal Heart Antibody Dilution: 1.0ug/ml |
|
Image 4 | Human Fetal Lung
| Host: Rabbit Target Name: SEMA6D Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|