SEMA6D Antibody - N-terminal region (ARP49583_P050)

Data Sheet
 
Product Number ARP49583_P050
Product Page www.avivasysbio.com/sema6d-antibody-n-terminal-region-arp49583-p050.html
Name SEMA6D Antibody - N-terminal region (ARP49583_P050)
Protein Size (# AA) 476 amino acids
Molecular Weight 52kDa
NCBI Gene Id 80031
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D
Alias Symbols FLJ11598, KIAA1479
Peptide Sequence Synthetic peptide located within the following region: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Toyofuku,T., (2004) Genes Dev. 18 (4), 435-447
Description of Target Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.
Protein Interactions PLXNA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SEMA6D (ARP49583_P050) antibody
Blocking Peptide For anti-SEMA6D (ARP49583_P050) antibody is Catalog # AAP49583 (Previous Catalog # AAPP13108)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SEMA6D
Uniprot ID Q8NFY4
Protein Name Semaphorin-6D
Protein Accession # NP_079242
Purification Affinity Purified
Nucleotide Accession # NM_024966
Tested Species Reactivity Human
Gene Symbol SEMA6D
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HeLa
WB Suggested Anti-SEMA6D Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Image 2
Human Adult Placenta
Host: Rabbit
Target Name: SEMA6D
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Heart
Host: Rabbit
Target Name: SEMA6D
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml
Image 4
Human Fetal Lung
Host: Rabbit
Target Name: SEMA6D
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com