| Product Number |
ARP49574_P050 |
| Product Page |
www.avivasysbio.com/sema6a-antibody-middle-region-arp49574-p050.html |
| Name |
SEMA6A Antibody - middle region (ARP49574_P050) |
| Protein Size (# AA) |
1030 amino acids |
| Molecular Weight |
114kDa |
| NCBI Gene Id |
57556 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A |
| Alias Symbols |
VIA, SEMA, HT018, SEMAQ, SEMA6A1 |
| Peptide Sequence |
Synthetic peptide located within the following region: ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Prislei,S., (2008) Mol. Cancer Ther. 7 (1), 233-241 |
| Description of Target |
SEMA6A can act as repulsive axon guidance cues. SEMA6A may play a role in channeling sympathetic axons into the sympathetic chains and controlling the temporal sequence of sympathetic target innervation. |
| Protein Interactions |
SUMO1; SH3RF1; ITSN2; SORBS1; SORBS2; EVL; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SEMA6A (ARP49574_P050) antibody |
| Blocking Peptide |
For anti-SEMA6A (ARP49574_P050) antibody is Catalog # AAP49574 (Previous Catalog # AAPP29424) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SEMA6A |
| Uniprot ID |
Q9H2E6 |
| Protein Name |
Semaphorin-6A |
| Sample Type Confirmation |
SEMA6A is supported by BioGPS gene expression data to be expressed in OVCAR3 |
| Protein Accession # |
NP_065847 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020796 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SEMA6A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93% |
| Image 1 | Human OVCAR-3
 | WB Suggested Anti-SEMA6A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysateSEMA6A is supported by BioGPS gene expression data to be expressed in OVCAR3 |
|
