| Product Number |
ARP49485_P050-Biotin |
| Product Page |
www.avivasysbio.com/sema4b-antibody-n-terminal-region-biotin-arp49485-p050-biotin.html |
| Name |
SEMA4B Antibody - N-terminal region : Biotin (ARP49485_P050-Biotin) |
| Protein Size (# AA) |
832 amino acids |
| Molecular Weight |
93kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
10509 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B |
| Alias Symbols |
SemC, SEMAC |
| Peptide Sequence |
Synthetic peptide located within the following region: KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Olsen,J.V., (2006) Cell 127 (3), 635-648 |
| Description of Target |
SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. |
| Protein Interactions |
UBC; DCBLD2; GIPC1; DLG4; PLXNB1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SEMA4B (ARP49485_P050-Biotin) antibody |
| Blocking Peptide |
For anti-SEMA4B (ARP49485_P050-Biotin) antibody is Catalog # AAP49485 (Previous Catalog # AAPS25108) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SEMA4B |
| Uniprot ID |
Q9NPR2 |
| Protein Name |
Semaphorin-4B |
| Protein Accession # |
NP_064595 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_020210 |
| Gene Symbol |
SEMA4B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | |
|
