CRLS1 Antibody - middle region : FITC (ARP49444_P050-FITC)

Data Sheet
 
Product Number ARP49444_P050-FITC
Product Page www.avivasysbio.com/crls1-antibody-middle-region-fitc-arp49444-p050-fitc.html
Name CRLS1 Antibody - middle region : FITC (ARP49444_P050-FITC)
Protein Size (# AA) 301 amino acids
Molecular Weight 32kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 54675
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cardiolipin synthase 1
Alias Symbols CLS, CLS1, GCD10, C20orf155, dJ967N21.6
Peptide Sequence Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target CRLS1 catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Protein Interactions FBXO15; PINK1; UBC; MCM6; MCM7;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CRLS1 (ARP49444_P050-FITC) antibody
Blocking Peptide For anti-CRLS1 (ARP49444_P050-FITC) antibody is Catalog # AAP49444 (Previous Catalog # AAPP29163)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CRLS1
Uniprot ID Q9UJA2
Protein Name Cardiolipin synthase
Publications

Croston, T. L. et al. Evaluation of the cardiolipin biosynthetic pathway and its interactions in the diabetic heart. Life Sci. 93, 313-22 (2013). WB, Bovine, Dog, Mouse, Pig, Horse, Rabbit, Rat, Guinea pig, Human, Zebrafish 23872101

Protein Accession # NP_061968
Purification Affinity Purified
Nucleotide Accession # NM_019095
Gene Symbol CRLS1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com