Product Number |
ARP49444_P050-FITC |
Product Page |
www.avivasysbio.com/crls1-antibody-middle-region-fitc-arp49444-p050-fitc.html |
Name |
CRLS1 Antibody - middle region : FITC (ARP49444_P050-FITC) |
Protein Size (# AA) |
301 amino acids |
Molecular Weight |
32kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
54675 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cardiolipin synthase 1 |
Alias Symbols |
CLS, CLS1, GCD10, C20orf155, dJ967N21.6 |
Peptide Sequence |
Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
CRLS1 catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol. |
Protein Interactions |
FBXO15; PINK1; UBC; MCM6; MCM7; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-CRLS1 (ARP49444_P050-FITC) antibody |
Blocking Peptide |
For anti-CRLS1 (ARP49444_P050-FITC) antibody is Catalog # AAP49444 (Previous Catalog # AAPP29163) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CRLS1 |
Uniprot ID |
Q9UJA2 |
Protein Name |
Cardiolipin synthase |
Publications |
Croston, T. L. et al. Evaluation of the cardiolipin biosynthetic pathway and its interactions in the diabetic heart. Life Sci. 93, 313-22 (2013). WB, Bovine, Dog, Mouse, Pig, Horse, Rabbit, Rat, Guinea pig, Human, Zebrafish 23872101 |
Protein Accession # |
NP_061968 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_019095 |
Gene Symbol |
CRLS1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | |
|