HLA-F Antibody - N-terminal region (ARP49411_P050)

• Product Number: ARP49411_P050
• Name: HLA-F Antibody - N-terminal region (ARP49411_P050)
• Protein Size (# AA): 442 amino acids
• Molecular Weight: 48kDa
• NCBI Gene Id: 3134
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Major histocompatibility complex, class I, F
• Alias Symbols: HLAF, CDA12, HLA-5.4, HLA-CDA12
• Peptide Sequence: Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Burfoot,R.K., (2008) Tissue Antigens 71 (1), 42-50
• Description of Target: HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene exhibits few polymorphisms. Multiple transcript variants encoding different isoforms have been found for this gene. These variants lack a coding exon found in transcripts from other HLA paralogues due to an altered splice acceptor site, resulting in a shorter cytoplasmic domain.
• Protein Interactions: UBC; LILRB2; LILRB1; TAP1; HLA-F; B2M;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HLA-F (ARP49411_P050) antibody is Catalog # AAP49411 (Previous Catalog # AAPP29130)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HLA-F
• Uniprot ID: P30511
• Protein Name: HLA class I histocompatibility antigen, alpha chain F
• Sample Type Confirmation:

  HLA-F is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_001091949
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001098479
• Tested Species Reactivity: Human
• Gene Symbol: HLA-F
• Predicted Species Reactivity: Human, Cow, Pig
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Human: 100%; Pig: 100%
• Image 1: Human 721_B
  
  WB Suggested Anti-HLA-F Antibody Titration: 0.2-1 ug/ml
  Positive Control: 721_B cell lysateHLA-F is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
• Image 2: Human Lung Tissue
  
  Rabbit Anti-HLA-F Antibody
  Catalog Number: ARP49411_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Membrane and cytoplasmic in alveolar type I cells
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec