| Product Number |
ARP49318_P050 |
| Product Page |
www.avivasysbio.com/tmem165-antibody-n-terminal-region-arp49318-p050.html |
| Name |
Tmem165 Antibody - N-terminal region (ARP49318_P050) |
| Protein Size (# AA) |
323 amino acids |
| Molecular Weight |
35 kDa |
| NCBI Gene Id |
21982 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Alias Symbols |
T, Tp, pFT2, Tparl, pFT27, Tpardl, AV026557 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Tmem165 (ARP49318_P050) antibody |
| Blocking Peptide |
For anti-Tmem165 (ARP49318_P050) antibody is Catalog # AAP49318 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tmem165 |
| Uniprot ID |
P52875 |
| Protein Name |
Transmembrane protein 165 |
| Protein Accession # |
NP_035756 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_011626 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Tmem165 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 85%; Human: 100%; Mouse: 93%; Rat: 93% |
| Image 1 | Mouse Stomach
 | Host: Rabbit
Target Name: Tmem165
Sample Type: Mouse Stomach lysates
Antibody Dilution: 1.0ug/ml |
| | Image 2 |
 | 25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|
|
