Product Number |
ARP49312_P050-FITC |
Product Page |
www.avivasysbio.com/lipt2-antibody-c-terminal-region-fitc-arp49312-p050-fitc.html |
Name |
LIPT2 Antibody - C-terminal region : FITC (ARP49312_P050-FITC) |
Protein Size (# AA) |
231 amino acids |
Molecular Weight |
25kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
387787 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: KICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Description of Target |
LIPT2 catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate. |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-LIPT2 (ARP49312_P050-FITC) antibody |
Blocking Peptide |
For anti-LIPT2 (ARP49312_P050-FITC) antibody is Catalog # AAP49312 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LIPT2 |
Uniprot ID |
A6NK58 |
Protein Name |
Putative lipoyltransferase 2, mitochondrial |
Protein Accession # |
NP_001138341 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001144869 |
Gene Symbol |
LIPT2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 93%; Mouse: 92%; Rabbit: 86%; Rat: 93%; Zebrafish: 79% |
Image 1 | |
|