LIPT2 Antibody - C-terminal region : FITC (ARP49312_P050-FITC)

Data Sheet
 
Product Number ARP49312_P050-FITC
Product Page www.avivasysbio.com/lipt2-antibody-c-terminal-region-fitc-arp49312-p050-fitc.html
Name LIPT2 Antibody - C-terminal region : FITC (ARP49312_P050-FITC)
Protein Size (# AA) 231 amino acids
Molecular Weight 25kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 387787
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: KICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target LIPT2 catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-LIPT2 (ARP49312_P050-FITC) antibody
Blocking Peptide For anti-LIPT2 (ARP49312_P050-FITC) antibody is Catalog # AAP49312
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LIPT2
Uniprot ID A6NK58
Protein Name Putative lipoyltransferase 2, mitochondrial
Protein Accession # NP_001138341
Purification Affinity Purified
Nucleotide Accession # NM_001144869
Gene Symbol LIPT2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 93%; Mouse: 92%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com