LIPT2 Antibody - C-terminal region (ARP49312_P050)

Data Sheet
 
Product Number ARP49312_P050
Product Page www.avivasysbio.com/lipt2-antibody-c-terminal-region-arp49312-p050.html
Name LIPT2 Antibody - C-terminal region (ARP49312_P050)
Protein Size (# AA) 231 amino acids
Molecular Weight 25kDa
NCBI Gene Id 387787
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Alias Symbols -
Peptide Sequence Synthetic peptide located within the following region: KICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target LIPT2 catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LIPT2 (ARP49312_P050) antibody
Blocking Peptide For anti-LIPT2 (ARP49312_P050) antibody is Catalog # AAP49312
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LIPT2
Uniprot ID A6NK58
Protein Name Putative lipoyltransferase 2, mitochondrial
Protein Accession # NP_001138341
Purification Affinity Purified
Nucleotide Accession # NM_001144869
Tested Species Reactivity Human
Gene Symbol LIPT2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 93%; Mouse: 92%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Image 1
Human 293T
Host: Rabbit
Target Name: LIPT2
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com