Product Number |
ARP49255_P050 |
Product Page |
www.avivasysbio.com/lipt2-antibody-c-terminal-region-arp49255-p050.html |
Name |
LIPT2 Antibody - C-terminal region (ARP49255_P050) |
Protein Size (# AA) |
231 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
387787 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Alias Symbols |
- |
Peptide Sequence |
Synthetic peptide located within the following region: TDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
LIPT2 catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LIPT2 (ARP49255_P050) antibody |
Blocking Peptide |
For anti-LIPT2 (ARP49255_P050) antibody is Catalog # AAP49255 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LIPT2 |
Uniprot ID |
A6NK58 |
Protein Name |
Putative lipoyltransferase 2, mitochondrial |
Protein Accession # |
NP_001138341 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001144869 |
Tested Species Reactivity |
Human |
Gene Symbol |
LIPT2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human Placenta
| Host: Rabbit Target Name: LIPT2 Sample Type: Placenta lysates Antibody Dilution: 1.0ug/ml |
|
|