POLQ Antibody - C-terminal region (ARP49203_P050)

• Name: POLQ Antibody - C-terminal region (ARP49203_P050)
• Protein Size (# AA): 1762 amino acids
• Molecular Weight: 290 kDa
• NCBI Gene Id: 10721
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Polymerase (DNA directed), theta
• Alias Symbols: PRO0327
• Peptide Sequence: Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.
• Protein Interactions: AP2S1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-POLQ (ARP49203_P050) antibody is Catalog # AAP49203 (Previous Catalog # AAPS24206)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ
• Uniprot ID: O75417
• Protein Name: DNA polymerase theta
• Protein Accession #: NP_955452.3
• Purification: Affinity Purified
• Nucleotide Accession #: NM_199420.3
• Tested Species Reactivity: Human
• Gene Symbol: POLQ
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
• Image 1: Human Thyroid
  
  Host: Rabbit
  Target Name: POLQ
  Sample Tissue: Human Thyroid
  Antibody Dilution: 1.0ug/ml