NUDT1 Antibody - middle region (ARP49190_P050)

• Product Number: ARP49190_P050
• Name: NUDT1 Antibody - middle region (ARP49190_P050)
• Protein Size (# AA): 197 amino acids
• Molecular Weight: 21kDa
• NCBI Gene Id: 4521
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: nudix hydrolase 1
• Alias Symbols: MTH1
• Peptide Sequence: Synthetic peptide located within the following region: WNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: N/A
• Description of Target: Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
• Protein Interactions: ACY1; UBC; DCUN1D1; COPS5; COPS6; CUL1; CUL2; CUL4B; CUL5; CAND1; RNMTL1; NTHL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NUDT1 (ARP49190_P050) antibody is Catalog # AAP49190
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human 8ODP
• Uniprot ID: P36639
• Protein Name: 7,8-dihydro-8-oxoguanine triphosphatase
• Purification: Affinity purified
• Tested Species Reactivity: Human
• Gene Symbol: NUDT1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
• Image 1: Human 293T Whole Cell
  
  Host: Rabbit
  Target Name: 8ODP
  Sample Type: 293T Whole Cell lysates
  Antibody Dilution: 1.0ug/ml