| Product Number |
ARP49127_P050 |
| Product Page |
www.avivasysbio.com/tmtc1-antibody-middle-region-arp49127-p050.html |
| Name |
TMTC1 Antibody - middle region (ARP49127_P050) |
| Protein Size (# AA) |
774 amino acids |
| Molecular Weight |
87kDa |
| NCBI Gene Id |
83857 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transmembrane and tetratricopeptide repeat containing 1 |
| Alias Symbols |
OLF, ARG99, TMTC1A |
| Peptide Sequence |
Synthetic peptide located within the following region: GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
| Description of Target |
TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TMTC1 (ARP49127_P050) antibody |
| Blocking Peptide |
For anti-TMTC1 (ARP49127_P050) antibody is Catalog # AAP49127 (Previous Catalog # AAPY02324) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TMTC1 |
| Uniprot ID |
Q8IUR5 |
| Protein Name |
Transmembrane and TPR repeat-containing protein 1 |
| Protein Accession # |
NP_787057 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_175861 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TMTC1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Yeast: 91% |
| Image 1 | Human Heart
 | WB Suggested Anti-TMTC1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart |
|
|
