| Product Number |
ARP49035_P050 |
| Product Page |
www.avivasysbio.com/ltc4s-antibody-n-terminal-region-arp49035-p050.html |
| Name |
LTC4S Antibody - N-terminal region (ARP49035_P050) |
| Protein Size (# AA) |
150 amino acids |
| Molecular Weight |
16kDa |
| NCBI Gene Id |
4056 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Leukotriene C4 synthase |
| Alias Symbols |
MGC33147 |
| Peptide Sequence |
Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. |
| Protein Interactions |
MGST1; LTC4S; ALOX5AP; ALOX5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LTC4S (ARP49035_P050) antibody |
| Blocking Peptide |
For anti-LTC4S (ARP49035_P050) antibody is Catalog # AAP49035 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LTC4S |
| Uniprot ID |
Q16873 |
| Protein Name |
Leukotriene C4 synthase |
| Protein Accession # |
NP_665874 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145867 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LTC4S |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Zebrafish: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-LTC4S Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell |
|
|
