| Product Number |
ARP48994_P050 |
| Product Page |
www.avivasysbio.com/chst14-antibody-middle-region-arp48994-p050.html |
| Name |
CHST14 Antibody - middle region (ARP48994_P050) |
| Protein Size (# AA) |
338 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
113189 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 |
| Alias Symbols |
ATCS, D4ST1, EDSMC1, HNK1ST |
| Peptide Sequence |
Synthetic peptide located within the following region: REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
CHST14 belongs to the sulfotransferase 2 family. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. It transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. It transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA-sequences. CHST14 has preference for partially desulfated dermatan sulfate. Addition of sulfate to GalNAc may occur immediately after epimerization of GlcUA to IdoUA. |
| Protein Interactions |
UBD; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHST14 (ARP48994_P050) antibody |
| Blocking Peptide |
For anti-CHST14 (ARP48994_P050) antibody is Catalog # AAP48994 (Previous Catalog # AAPY02145) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHST14 |
| Uniprot ID |
Q8NCH0 |
| Protein Name |
Carbohydrate sulfotransferase 14 |
| Publications |
The phenotype of the musculocontractural type of Ehlers-Danlos syndrome due to CHST14 mutations. Am. J. Med. Genet. A. 170A, 103-15 (2016). 26373698 |
| Protein Accession # |
AAH23653 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
Q8NCH0 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHST14 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CHST14 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
