| Product Number |
ARP48903_P050 |
| Product Page |
https://www.avivasysbio.com/qtrt2-antibody-n-terminal-region-arp48903-p050.html |
| Name |
QTRT2 Antibody - N-terminal region (ARP48903_P050) |
| Protein Size (# AA) |
415 amino acids |
| Molecular Weight |
47kDa |
| Subunit |
QTRTD1 |
| NCBI Gene Id |
79691 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
queuine tRNA-ribosyltransferase accessory subunit 2 |
| Alias Symbols |
QTRTD1 |
| Peptide Sequence |
Synthetic peptide located within the following region: YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes a subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine, and tyrosine. The encoded protein may play a role in the queuosine 5'-monophosphate salvage pathway. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Protein Interactions |
SUMO2; UBC; SUMO1; NEDD8; ALB; WAC; UBD; ISG15; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-QTRT2 (ARP48903_P050) antibody |
| Blocking Peptide |
For anti-QTRT2 (ARP48903_P050) antibody is Catalog # AAP48903 (Previous Catalog # AAPP28954) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human QTRTD1 |
| Uniprot ID |
Q9H974 |
| Protein Name |
queuine tRNA-ribosyltransferase accessory subunit 2 |
| Protein Accession # |
NP_078914 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024638 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
QTRT2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Heart
 | WB Suggested Anti-QTRTD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart |
|
|
