| Product Number |
ARP48718_T100-FITC |
| Product Page |
www.avivasysbio.com/sdf2-antibody-n-terminal-region-fitc-arp48718-t100-fitc.html |
| Name |
SDF2 Antibody - N-terminal region : FITC (ARP48718_T100-FITC) |
| Protein Size (# AA) |
211 amino acids |
| Molecular Weight |
21kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
6388 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Stromal cell-derived factor 2 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Hamada,T., Gene 176 (1-2), 211-214 (1996) |
| Description of Target |
SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. |
| Protein Interactions |
HNRNPD; env; SUMO1; DMWD; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-SDF2 (ARP48718_T100-FITC) antibody |
| Additional Information |
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-SDF2 (ARP48718_T100-FITC) antibody is Catalog # AAP48718 (Previous Catalog # AAPP28768) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SDF2 |
| Uniprot ID |
Q99470 |
| Protein Name |
Stromal cell-derived factor 2 |
| Sample Type Confirmation |
SDF2 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_008854 |
| Nucleotide Accession # |
NM_006923 |
| Gene Symbol |
SDF2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | |
