CDY1 Antibody - C-terminal region (ARP48645_T100)

Data Sheet
 
Product Number ARP48645_T100
Product Page www.avivasysbio.com/cdy1-antibody-c-terminal-region-arp48645-t100.html
Name CDY1 Antibody - C-terminal region (ARP48645_T100)
Protein Size (# AA) 554 amino acids
Molecular Weight 62kDa
NCBI Gene Id 9085
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Chromodomain protein, Y-linked, 1
Alias Symbols CDY, CDY1A
Peptide Sequence Synthetic peptide located within the following region: FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Stouffs,K., (2008) Hum. Reprod. 23 (5), 1193-1199
Description of Target CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.This gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. The human chromosome Y has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. Two protein isoforms are encoded by transcript variants of this gene. Additional transcript variants have been described, but their full-length nature has not been determined.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CDY1 (ARP48645_T100) antibody
Blocking Peptide For anti-CDY1 (ARP48645_T100) antibody is Catalog # AAP48645 (Previous Catalog # AAPS23812)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CDY1
Uniprot ID A8K8F3
Protein Name cDNA FLJ76680, highly similar to Homo sapiens chromodomain protein, Y-linked, 1 (CDY1), transcript variant 2, mRNA EMBL BAF85007.1
Protein Accession # NP_004671
Purification Protein A purified
Nucleotide Accession # NM_004680
Tested Species Reactivity Human
Gene Symbol CDY1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 86%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-CDY1 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com