Product Number |
ARP48645_T100 |
Product Page |
www.avivasysbio.com/cdy1-antibody-c-terminal-region-arp48645-t100.html |
Name |
CDY1 Antibody - C-terminal region (ARP48645_T100) |
Protein Size (# AA) |
554 amino acids |
Molecular Weight |
62kDa |
NCBI Gene Id |
9085 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chromodomain protein, Y-linked, 1 |
Alias Symbols |
CDY, CDY1A |
Peptide Sequence |
Synthetic peptide located within the following region: FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Stouffs,K., (2008) Hum. Reprod. 23 (5), 1193-1199 |
Description of Target |
CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein.This gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. The human chromosome Y has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. Two protein isoforms are encoded by transcript variants of this gene. Additional transcript variants have been described, but their full-length nature has not been determined. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CDY1 (ARP48645_T100) antibody |
Blocking Peptide |
For anti-CDY1 (ARP48645_T100) antibody is Catalog # AAP48645 (Previous Catalog # AAPS23812) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CDY1 |
Uniprot ID |
A8K8F3 |
Protein Name |
cDNA FLJ76680, highly similar to Homo sapiens chromodomain protein, Y-linked, 1 (CDY1), transcript variant 2, mRNA EMBL BAF85007.1 |
Protein Accession # |
NP_004671 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_004680 |
Tested Species Reactivity |
Human |
Gene Symbol |
CDY1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 86%; Rat: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-CDY1 Antibody Titration: 2.5ug/ml Positive Control: HepG2 cell lysate |
|
|