PAPSS2 Antibody - C-terminal region (ARP48642_P050)

• Product Number: ARP48642_P050
• Name: PAPSS2 Antibody - C-terminal region (ARP48642_P050)
• Protein Size (# AA): 619 amino acids
• Molecular Weight: 70kDa
• NCBI Gene Id: 9060
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• Alias Symbols: SK2, BCYM4, ATPSK2
• Peptide Sequence: Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
• Description of Target: Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. PAPSS2 is one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene.
• Protein Interactions: RIC8A; ARIH2; GTF3C4; TXNRD1; TUBB2A; HNRNPA2B1; APEX1; UBD; UBC; APP; Papss1; VHL;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PAPSS2 (ARP48642_P050) antibody is Catalog # AAP48642 (Previous Catalog # AAPY01614)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PAPSS2
• Uniprot ID: O95340-2
• Protein Name: Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 2
• Sample Type Confirmation:

  PAPSS2 is strongly supported by BioGPS gene expression data to be expressed in HeLa

  There is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B

• Protein Accession #: NP_001015880
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001015880
• Tested Species Reactivity: Human
• Gene Symbol: PAPSS2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human 293T
  
  WB Suggested Anti-PAPSS2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 293T cell lysate
• Image 2: Human Lung Tissue
  
  PAPSS2 antibody - C-terminal region (ARP48642_P050)
  Catalog Number: ARP48642_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasm of pneumocytes
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 3: Human Liver Tissue
  
  PAPSS2 antibody - C-terminal region (ARP48642_P050)
  Catalog Number: ARP48642_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
  Observed Staining: Cytoplasm in hepatocytes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 4: Human 721_B
  
  Host: Rabbit
  Target Name: PAPSS2
  Sample Type: Human 721_B
  Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B
• Image 5: Human HeLa
  
  Host: Rabbit
  Target Name: PAPSS2
  Sample Type: Human Hela
  Antibody Dilution: 1.0ug/mlPAPSS2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells