MAP4K2 Antibody - N-terminal region (ARP48631_P050)

• Product Number: ARP48631_P050
• Name: MAP4K2 Antibody - N-terminal region (ARP48631_P050)
• Protein Size (# AA): 820 amino acids
• Molecular Weight: 92 kDa
• NCBI Gene Id: 5871
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mitogen-activated protein kinase kinase kinase kinase 2
• Alias Symbols: GCK, BL44, RAB8IP
• Peptide Sequence: Synthetic peptide located within the following region: TVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Wissing,J., (2007) Mol. Cell Proteomics 6 (3), 537-547
• Description of Target: MAP4K2 is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.The protein encoded by this gene is a member of the serine/threonine protein kinase family. Although this kinase is found in many tissues, its expression in lymphoid follicles is restricted to the cells of germinal centre, where it may participate in B-cell differentiation. This kinase can be activated by TNF-alpha, and has been shown to specifically activate MAP kinases. This kinase is also found to interact with TNF receptor-associated factor 2 (TRAF2), which is involved in the activation of MAP3K1/MEKK1.
• Protein Interactions: HSP90AA1; UBC; MAP3K11; MAP3K1; POT1; MCM3AP-AS1; NACAD; SNRNP35; PRDX4; SERPINA4; HNRNPA2B1; XRCC6; DEFB1; TRAF2; RAB8A; MAP2K4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MAP4K2 (ARP48631_P050) antibody is Catalog # AAP48631 (Previous Catalog # AAPY01605)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAP4K2
• Uniprot ID: Q12851
• Protein Name: Mitogen-activated protein kinase kinase kinase kinase 2
• Protein Accession #: NP_004570
• Purification: Affinity Purified
• Nucleotide Accession #: NM_004579
• Tested Species Reactivity: Human
• Gene Symbol: MAP4K2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86%
• Image 1:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.