| Product Number |
ARP48531_P050 |
| Product Page |
www.avivasysbio.com/sult6b1-antibody-c-terminal-region-arp48531-p050.html |
| Name |
SULT6B1 Antibody - C-terminal region (ARP48531_P050) |
| Protein Size (# AA) |
265 amino acids |
| Molecular Weight |
30kDa |
| NCBI Gene Id |
391365 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Sulfotransferase family, cytosolic, 6B, member 1 |
| Alias Symbols |
ST6B1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Siebert,G., PLoS Biol. 5 (5), E97 (2007) |
| Description of Target |
SULT6B1 belongs to the sulfotransferase 1 family. SULT6B1 may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SULT6B1 (ARP48531_P050) antibody |
| Blocking Peptide |
For anti-SULT6B1 (ARP48531_P050) antibody is Catalog # AAP48531 (Previous Catalog # AAPY01475) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SULT6B1 |
| Uniprot ID |
Q6IMI4 |
| Protein Name |
Sulfotransferase 6B1 |
| Protein Accession # |
NP_001027549 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001032377 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SULT6B1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 92%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 92%; Rat: 86% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SULT6B1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
