| Product Number |
ARP48346_P050 |
| Product Page |
www.avivasysbio.com/gadd45b-antibody-middle-region-arp48346-p050.html |
| Name |
GADD45B Antibody - middle region (ARP48346_P050) |
| Protein Size (# AA) |
160 amino acids |
| Molecular Weight |
18kDa |
| NCBI Gene Id |
4616 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Growth arrest and DNA-damage-inducible, beta |
| Description |
|
| Alias Symbols |
MYD118, GADD45BETA |
| Peptide Sequence |
Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Tornatore,L., (2008) J. Mol. Biol. 378 (1), 97-111 |
| Description of Target |
The function of GADD45B is involved in the regulation of growth and apoptosis.This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
UBD; UBC; MAP3K4; GADD45GIP1; GADD45G; MAP2K7; MAP3K5; PPARG; PPARD; PCNA; PPARA; ESR1; CCNB1; CDK1; CDKN1A; GADD45A; EGR1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GADD45B (ARP48346_P050) antibody |
| Blocking Peptide |
For anti-GADD45B (ARP48346_P050) antibody is Catalog # AAP48346 (Previous Catalog # AAPY01724) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GADD45B |
| Uniprot ID |
O75293 |
| Protein Name |
Growth arrest and DNA damage-inducible protein GADD45 beta |
| Publications |
ALK5 signaling pathway mediates neurogenesis and functional recovery after cerebral ischemia/reperfusion in rats via Gadd45b. Cell Death Dis. 10, 360 (2019). 31043581
Babu, E. et al. Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate. Oncogene 30, 4026-37 (2011). 21505039
BDNF rs6265 methylation and genotype interact on risk for schizophrenia. Epigenetics. 11, 11-23 (2016). 26889735
Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). 22048458
Role of Growth Arrest and DNA Damage-Inducible, Beta in Alcohol-Drinking Behaviors. Alcohol. Clin. Exp. Res. 40, 263-72 (2016). 26842245 |
| Protein Accession # |
NP_056490 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_015675 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
GADD45B |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-GADD45B Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
| Image 2 | Human Fetal Lung
 | Host: Rabbit
Target Name: GA45B
Sample Type: Fetal Lung lysates
Antibody Dilution: 3.0ug/ml |
|
| Image 3 | Mouse Small Intestine
 | Host: Mouse
Target Name: GADD45B
Sample Tissue: Mouse Small Intestine
Antibody Dilution: 1ug/ml |
|
| Image 4 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: GADD45B
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 5 | Human Lung Tumor
 | Host: Rabbit
Target Name: GADD45B
Sample Tissue: Human Lung Tumor
Antibody Dilution: 1ug/ml |
|
| Image 6 | Human Prostate Cancer
 | Sample Type: Human Prostate Cancer
Primary Antibody Dilution: 2ug/mL
Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue)
Gene Name: GADD45B |
|
| Image 7 | Human Prostate Cancer
 | Sample Type: Human Prostate Cancer
Primary Antibody Dilution: 2ug/mL
Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue)
Gene Name: GADD45B |
|
| Image 8 | Human Prostate Cancer
 | Sample Type: Human Prostate Cancer
Primary Antibody Dilution: 2ug/mL
Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue)
Gene Name: GADD45B |
|
