| Product Number |
ARP48306_P050 |
| Product Page |
www.avivasysbio.com/rabl4-antibody-c-terminal-region-arp48306-p050.html |
| Name |
RABL4 Antibody - C-terminal region (ARP48306_P050) |
| Protein Size (# AA) |
185 amino acids |
| Molecular Weight |
20kDa |
| NCBI Gene Id |
11020 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Intraflagellar transport 27 homolog (Chlamydomonas) |
| Alias Symbols |
RAYL, BBS19, RABL4, FAP156 |
| Peptide Sequence |
Synthetic peptide located within the following region: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Collins,J.E., Genome Biol. 5 (10), R84 (2004) |
| Description of Target |
RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.This gene encodes a putative GTP-binding protein similar to RAY/RAB1C. The protein is ras-related, but the function is unknown. |
| Protein Interactions |
HSPB11; GOLGA2; PRDX5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-IFT27 (ARP48306_P050) antibody |
| Blocking Peptide |
For anti-IFT27 (ARP48306_P050) antibody is Catalog # AAP48306 (Previous Catalog # AAPY01676) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RABL4 |
| Uniprot ID |
Q9BW83-2 |
| Protein Name |
Intraflagellar transport protein 27 homolog |
| Sample Type Confirmation |
IFT27 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_006851 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006860 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
IFT27 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Human: 100%; Mouse: 79%; Pig: 85%; Rat: 79%; Sheep: 86% |
| Image 1 | Human Adult Liver
 | Rabbit Anti-RABL4 Antibody
Catalog Number: ARP48306_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver
Observed Staining: Cytoplasm in hepatocytes surrounding the portal vein only, signal is strong but tissue abundance is low
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 2.0 sec
Protocol located in Reviews and Data. |
|
| Image 2 | Human 721_B
 | WB Suggested Anti-RABL4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateIFT27 is supported by BioGPS gene expression data to be expressed in 721_B |
|
