EIF3M Antibody - N-terminal region (ARP48293_T100)

• Product Number: ARP48293_T100
• Name: EIF3M Antibody - N-terminal region (ARP48293_T100)
• Protein Size (# AA): 374 amino acids
• Molecular Weight: 43 kDa
• Subunit: M
• NCBI Gene Id: 10480
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Eukaryotic translation initiation factor 3, subunit M
• Alias Symbols: B5, GA17, PCID1, TANGO7, hfl-B5
• Peptide Sequence: Synthetic peptide located within the following region: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kobayashi,K., Brain Res. 1170, 129-139 (2007)
• Description of Target: EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV) (Perez et al., 2005 [PubMed 15919898]).[supplied by OMIM].
• Protein Interactions: HUWE1; FAM96B; UBC; SUMO2; rev; SRPK1; EXOSC10; NPM1; MMS19; gag-pol; EIF3D; EIF3F; EIF3L; EIF3K; EIF3I; EIF3H; EIF3G; EIF3C; EIF3B; EIF3A; EIF3E; APP; TADA2A; EIF1B; EIF4A2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-EIF3M (ARP48293_T100) antibody is Catalog # AAP48293 (Previous Catalog # AAPY01662)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3M
• Uniprot ID: Q7L2H7
• Protein Name: Eukaryotic translation initiation factor 3 subunit M
• Publications:

  Cheshenko, N., Trepanier, J. B., Segarra, T. J., Fuller, A. O. & Herold, B. C. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One 5, e11829 (2010). 20676407

• Sample Type Confirmation:

  There is BioGPS gene expression data showing that EIF3M is expressed in HepG2

• Protein Accession #: NP_006351
• Purification: Protein A purified
• Nucleotide Accession #: NM_006360
• Tested Species Reactivity: Human
• Gene Symbol: EIF3M
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human kidney
  
  Human kidney
• Image 2:
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.