IDH2 Antibody - middle region (ARP48207_P050)

Data Sheet
 
Product Number ARP48207_P050
Product Page www.avivasysbio.com/idh2-antibody-middle-region-arp48207-p050.html
Name IDH2 Antibody - middle region (ARP48207_P050)
Protein Size (# AA) 452 amino acids
Molecular Weight 47kDa
NCBI Gene Id 3418
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Isocitrate dehydrogenase 2 (NADP+), mitochondrial
Alias Symbols IDH, IDP, IDHM, IDPM, ICD-M, D2HGA2, mNADP-IDH
Peptide Sequence Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shin,S.W., (2008) Biochem. Biophys. Res. Commun. 366 (4), 1012-1018
Description of Target Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. IDH2 is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions UBC; SUMO1; NEDD8; MDM2; ADRB2; HDAC1; PYGL; CDK2; SLC2A4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-IDH2 (ARP48207_P050) antibody
Blocking Peptide For anti-IDH2 (ARP48207_P050) antibody is Catalog # AAP48207 (Previous Catalog # AAPS22805)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IDH2
Uniprot ID P48735
Protein Name Isocitrate dehydrogenase [NADP], mitochondrial
Publications

Vohwinkel, C. U. et al. Elevated CO(2) levels cause mitochondrial dysfunction and impair cell proliferation. J. Biol. Chem. 286, 37067-76 (2011). 21903582

Protein Accession # NP_002159
Purification Affinity Purified
Nucleotide Accession # NM_002168
Tested Species Reactivity Human, Mouse, Rat
Gene Symbol IDH2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Image 1
Mouse Small Intestine
Host: Mouse
Target Name: IDH2
Sample Tissue: Mouse Small Intestine
Antibody Dilution: 1ug/ml
Image 2
Mouse Small Intestine
Host: Rabbit
Target Name: IDH2
Sample Tissue: Mouse Small Intestine
Antibody Dilution: 1ug/ml
Image 3
Human heart, Human brain
Host: Rabbit
Target: IDH2
Positive control (+): Human heart (HE)
Negative control (-): Human brain (BR)
Antibody concentration: 1ug/ml
Image 4
Human Muscle
WB Suggested Anti-IDH2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle
Image 5
Rat kidney
IDH2 antibody - middle region (ARP48207_P050) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com