Product Number |
ARP48207_P050 |
Product Page |
www.avivasysbio.com/idh2-antibody-middle-region-arp48207-p050.html |
Name |
IDH2 Antibody - middle region (ARP48207_P050) |
Protein Size (# AA) |
452 amino acids |
Molecular Weight |
47kDa |
NCBI Gene Id |
3418 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Isocitrate dehydrogenase 2 (NADP+), mitochondrial |
Alias Symbols |
IDH, IDP, IDHM, IDPM, ICD-M, D2HGA2, mNADP-IDH |
Peptide Sequence |
Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Shin,S.W., (2008) Biochem. Biophys. Res. Commun. 366 (4), 1012-1018 |
Description of Target |
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. IDH2 is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
UBC; SUMO1; NEDD8; MDM2; ADRB2; HDAC1; PYGL; CDK2; SLC2A4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-IDH2 (ARP48207_P050) antibody |
Blocking Peptide |
For anti-IDH2 (ARP48207_P050) antibody is Catalog # AAP48207 (Previous Catalog # AAPS22805) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human IDH2 |
Uniprot ID |
P48735 |
Protein Name |
Isocitrate dehydrogenase [NADP], mitochondrial |
Publications |
Vohwinkel, C. U. et al. Elevated CO(2) levels cause mitochondrial dysfunction and impair cell proliferation. J. Biol. Chem. 286, 37067-76 (2011). 21903582 |
Protein Accession # |
NP_002159 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002168 |
Tested Species Reactivity |
Human, Mouse, Rat |
Gene Symbol |
IDH2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100% |
Image 1 | Mouse Small Intestine
| Host: Mouse Target Name: IDH2 Sample Tissue: Mouse Small Intestine Antibody Dilution: 1ug/ml |
|
Image 2 | Mouse Small Intestine
| Host: Rabbit Target Name: IDH2 Sample Tissue: Mouse Small Intestine Antibody Dilution: 1ug/ml |
|
Image 3 | Human heart, Human brain
| Host: Rabbit Target: IDH2 Positive control (+): Human heart (HE) Negative control (-): Human brain (BR) Antibody concentration: 1ug/ml |
|
Image 4 | Human Muscle
| WB Suggested Anti-IDH2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Human Muscle |
|
Image 5 | Rat kidney
| IDH2 antibody - middle region (ARP48207_P050) validated by WB using Proximal kidney tubules purfied from cortex at 1:1000. |
|