| Product Number |
ARP48205_T100 |
| Product Page |
www.avivasysbio.com/got1-antibody-n-terminal-region-arp48205-t100.html |
| Name |
GOT1 Antibody - N-terminal region (ARP48205_T100) |
| Protein Size (# AA) |
413 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
2805 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1) |
| Description |
|
| Alias Symbols |
AST1, cCAT, GIG18, cAspAT, ASTQTL1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Inoue,K., Diabetes Res. Clin. Pract. 79 (3), E4-E7 (2008) |
| Description of Target |
Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
UBC; CHRAC1; SBDS; UBE2H; TYMS; MTAP; IDH1; HPRT1; ANXA6; ABI3BP; EGFR; TMEM120A; PC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GOT1 (ARP48205_T100) antibody |
| Blocking Peptide |
For anti-GOT1 (ARP48205_T100) antibody is Catalog # AAPY01517 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GOT1 |
| Uniprot ID |
P17174 |
| Protein Name |
Aspartate aminotransferase, cytoplasmic |
| Publications |
Protection against myocardial ischemia-reperfusion injury at onset of type 2 diabetes in Zucker diabetic fatty rats is associated with altered glucose oxidation. PLoS One. 8, e64093 (2013). 23704975 |
| Sample Type Confirmation |
GOT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
| Protein Accession # |
NP_002070 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002079 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GOT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 85% |
| Image 1 | Human NCI-H226
 | Host: Rabbit
Target Name: GOT1
Sample Type: NCI-H226
Antibody Dilution: 1.0ug/mlGOT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
| Image 2 | Human NCI-H226
 | WB Suggested Anti-GOT1 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysateGOT1 is supported by BioGPS gene expression data to be expressed in NCIH226 |
|
| Image 3 | Human Fetal Liver
 | Host: Rabbit
Target Name: GOT1
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
