| Product Number |
ARP48203_T100 |
| Product Page |
www.avivasysbio.com/eno3-antibody-n-terminal-region-arp48203-t100.html |
| Name |
ENO3 Antibody - N-terminal region (ARP48203_T100) |
| Protein Size (# AA) |
434 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
2027 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Enolase 3 (beta, muscle) |
| Description |
|
| Alias Symbols |
MSE, GSD13 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Li,T.B., (2004) Acta Biochim. Biophys. Sin. (Shanghai) 36 (6), 412-418 |
| Description of Target |
ENO3 is one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in ENO3 gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme.This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5' UTR. |
| Protein Interactions |
UBC; IQCB1; DAK; PKM; GPI; ENO1; EEF1A1; APP; SUMO1; PNKD; TRIM63; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Enhanced Validation |
| Relative Expression (Western Blot) |
 |
|
| Datasheets/Manuals |
Printable datasheet for anti-ENO3 (ARP48203_T100) antibody |
| Additional Information |
IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 5.0 ug/ml. Gel concentration: 12%. |
| Blocking Peptide |
For anti-ENO3 (ARP48203_T100) antibody is Catalog # AAP48203 (Previous Catalog # AAPS22802) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ENO3 |
| Uniprot ID |
P13929 |
| Protein Name |
Beta-enolase |
| Publications |
Chaika, N. V et al. Differential expression of metabolic genes in tumor and stromal components of primary and metastatic loci in pancreatic adenocarcinoma. PLoS One 7, e32996 (2012). 22412968 |
| Sample Type Confirmation |
ENO3 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_001967 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001976 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ENO3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|
