CAMLG Antibody - N-terminal region (ARP48191_P050)

• Name: CAMLG Antibody - N-terminal region (ARP48191_P050)
• Protein Size (# AA): 296 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 819
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Calcium modulating ligand
• Alias Symbols: CAML, GET2
• Peptide Sequence: Synthetic peptide located within the following region: LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Nagano,J., (2005) Biochem. Biophys. Res. Commun. 338 (2), 880-889
• Description of Target: The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. CAMLG functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.
• Protein Interactions: KCNA2; TMUB1; TNFRSF13B; UBC; RNF122; PKHD1; EGFR; PPIB; IER3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CAMLG (ARP48191_P050) antibody is Catalog # AAP48191 (Previous Catalog # AAPS22702)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMLG
• Uniprot ID: P49069
• Protein Name: Calcium signal-modulating cyclophilin ligand
• Protein Accession #: NP_001736
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001745
• Tested Species Reactivity: Human
• Gene Symbol: CAMLG
• Predicted Species Reactivity: Human, Mouse, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 85%
• Image 1: Human Liver
  
  WB Suggested Anti-CAMLG Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: Human Liver