ATP5F1B Antibody - C-terminal region (ARP48186_T100)

• Product Number: ARP48186_T100
• Name: ATP5F1B Antibody - C-terminal region (ARP48186_T100)
• Protein Size (# AA): 529 amino acids
• Molecular Weight: 57 kDa
• Subunit: beta, mitochondrial
• NCBI Gene Id: 506
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: ATP synthase F1 subunit beta
• Alias Symbols: ATP5B, ATPMB, ATPSB, HEL-S-271
• Peptide Sequence: Synthetic peptide located within the following region: MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Vantourout,P., (2008) Mol. Immunol. 45 (2), 485-492
• Description of Target: This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core.
• Protein Interactions: FUS; FDX1; ATP5A1; HUWE1; ATPAF2; TRIM63; TRIM55; SPRTN; STAU1; GRSF1; UBC; MDM2; ASB5; ASB11; SUZ12; RNF2; EZH2; BMI1; GBP1; ADRB2; TERT; vpu; UBL4A; WHSC1; VCAM1; PPP1CC; ITGA4; FN1; ESR1; ATF2; BTK; YWHAE; SUMO2; CA9; FMNL1; ATP5O; ATP6V1B2; ATP5C1; AT
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Additional Information: IHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
• Other Applications Image 1 Data: IP Suggested Anti-ATP5B antibody
  Titration: 2 ug/ml
  Positive Control: Mouse brain homogenate
  
• Blocking Peptide: For anti-ATP5F1B (ARP48186_T100) antibody is Catalog # AAP48186 (Previous Catalog # AAPP28695)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATP5B
• Uniprot ID: P06576
• Protein Name: ATP synthase subunit beta, mitochondrial
• Publications:

  Rubel, C. E. et al. Diggin’ on u(biquitin): a novel method for the identification of physiological E3 ubiquitin ligase substrates. Cell Biochem. Biophys. 67, 127-38 (2013). 23695782

  Teodoro, J. S. et al. Berberine reverts hepatic mitochondrial dysfunction in high-fat fed rats: a possible role for SirT3 activation. Mitochondrion 13, 637-46 (2013). 24041461

  Usui, T. et al. Elevated mitochondrial biogenesis in skeletal muscle is associated with testosterone-induced body weight loss in male mice. FEBS Lett. 588, 1935-41 (2014). 24726723

• Protein Accession #: NP_001677
• Purification: Protein A purified
• Nucleotide Accession #: NM_001686
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: ATP5F1B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Application: IHC, IP, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 79%
• Image 1: Human Brain
  
  Sample Type: NT2 cells Red: Antibody Blue: DAPI Primary Dilution: 1ug/50ul antibody Secondary Antibody: Alexa goat anti-rabbit 594 Image Submitted by: Yuzhi Chen, University of Arkansas for Medical Sciences
• Image 2:
  
  25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by phosphorylation.