EIF3E Antibody - N-terminal region (ARP48175_P050)

Data Sheet
 
Product Number ARP48175_P050
Product Page www.avivasysbio.com/eif3e-antibody-n-terminal-region-arp48175-p050.html
Name EIF3E Antibody - N-terminal region (ARP48175_P050)
Protein Size (# AA) 445 amino acids
Molecular Weight 52kDa
Subunit E
NCBI Gene Id 3646
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Eukaryotic translation initiation factor 3, subunit E
Alias Symbols INT6, EIF3S6, EIF3-P48, eIF3-p46
Peptide Sequence Synthetic peptide located within the following region: ELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Buchsbaum,S., (2007) Oncogene 26 (35), 5132-5144
Description of Target EIF3E belongs to the eIF-3 subunit E family.It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. EIF3E is required for nonsense-mediated mRNA decay (NMD); It may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. The protein may interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.
Protein Interactions UBC; C4orf19; RUNDC3A; HUWE1; TRIM63; TRIM55; STAU1; SUMO1; NEDD8; GPRASP2; LARP1; GNB2L1; RPS28; RPS25; RPS23; RPS20; RPS19; RPS18; RPS12; RPS10; RPS9; RPS8; RPS3A; RPS3; RPS2; EIF3CL; DYNC1LI1; FBXO6; EIF3D; IGSF8; NPM1; ICAM1; CD81; EIF3B; VCAM1; POLR2
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EIF3E (ARP48175_P050) antibody
Additional Information IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 5 ug/ml.
Blocking Peptide For anti-EIF3E (ARP48175_P050) antibody is Catalog # AAP48175 (Previous Catalog # AAPP28684)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human EIF3E
Uniprot ID P60228
Protein Name Eukaryotic translation initiation factor 3 subunit E
Sample Type Confirmation

EIF3E is supported by BioGPS gene expression data to be expressed in HEK293T

Protein Accession # NP_001559
Purification Affinity Purified
Nucleotide Accession # NM_001568
Tested Species Reactivity Human
Gene Symbol EIF3E
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75%
Image 1
Human 293T
WB Suggested Anti-EIF3E Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysateEIF3E is supported by BioGPS gene expression data to be expressed in HEK293T
Image 2
Human, Mouse
EIF3E antibody - N-terminal region (ARP48175_P050) validated by WB using B8 mouse cells and HEK293 human cells at 1: 1,000.
Image 3
Human Kidney
Kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com