IGFBP7 Antibody - C-terminal region (ARP48174_P050)

Data Sheet
 
Product Number ARP48174_P050
Product Page www.avivasysbio.com/igfbp7-antibody-c-terminal-region-arp48174-p050.html
Name IGFBP7 Antibody - C-terminal region (ARP48174_P050)
Protein Size (# AA) 282 amino acids
Molecular Weight 29 kDa
NCBI Gene Id 3490
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Insulin-like growth factor binding protein 7
Alias Symbols AGM, PSF, TAF, FSTL2, IBP-7, MAC25, IGFBP-7, RAMSVPS, IGFBP-7v, IGFBPRP1
Peptide Sequence Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wajapeyee,N., (2008) Cell 132 (3), 363-374
Description of Target IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.
Protein Interactions RBBP8; HNF1A; RTN4; DSTN; UBC; CHMP3; CCL21; VEGFA; CCL5; SDC1; INS; IGF2; IGF1; CXCL10; INHBA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-IGFBP7 (ARP48174_P050) antibody
Blocking Peptide For anti-IGFBP7 (ARP48174_P050) antibody is Catalog # AAP48174 (Previous Catalog # AAPY02582)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human IGFBP7
Uniprot ID Q16270
Protein Name Insulin-like growth factor-binding protein 7
Protein Accession # NP_001544
Purification Affinity Purified
Nucleotide Accession # NM_001553
Tested Species Reactivity Human, Mouse
Gene Symbol IGFBP7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Image 1
Human Lung Tissue
IGFBP7 antibody - C-terminal region (ARP48174_P050)
Catalog Number: ARP48174_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Cytoplasm and membrane of pneumocytes
Primary Antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human Muscle
WB Suggested Anti-IGFBP7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle
Image 3
Mouse Skeletal Muscle
Host: Mouse
Target Name: IGFBP7
Sample Tissue: Mouse Skeletal Muscle
Antibody Dilution: 1ug/ml
Image 4

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. The protein may be slightly modified by both glycosylation and phosphorylation.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com