| Product Number |
ARP48147_P050 |
| Product Page |
www.avivasysbio.com/umps-antibody-c-terminal-region-arp48147-p050.html |
| Name |
UMPS Antibody - C-terminal region (ARP48147_P050) |
| Protein Size (# AA) |
480 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
7372 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Uridine monophosphate synthetase |
| Alias Symbols |
OPRT |
| Peptide Sequence |
Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Sakamoto,E., (2007) Biochem. Biophys. Res. Commun. 363 (1), 216-222 |
| Description of Target |
OPRT (UMPS) is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas. Orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma. Determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy. |
| Protein Interactions |
UBC; CALU; PLA2G12A; ZNF227; RPS29; PAXIP1; PSEN1; NOS3; APRT; A2M; CUL3; USP50; CDC42EP3; DLST; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-UMPS (ARP48147_P050) antibody |
| Blocking Peptide |
For anti-UMPS (ARP48147_P050) antibody is Catalog # AAP48147 (Previous Catalog # AAPP13022) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human UMPS |
| Uniprot ID |
P11172 |
| Protein Name |
Uridine 5'-monophosphate synthase |
| Sample Type Confirmation |
UMPS is strongly supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_000364 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000373 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
UMPS |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%; Yeast: 75% |
| Image 1 | Human 721_B
 | WB Suggested Anti-UMPS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateUMPS is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells |
|
| Image 2 | Human Adult Placenta
 | Host: Rabbit
Target Name: UMPS
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human Fetal Heart
 | Host: Rabbit
Target Name: UMPS
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml |
|
| Image 4 | Human Fetal Liver
 | Host: Rabbit
Target Name: UMPS
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml |
|
| Image 5 | Human Fetal Lung
 | Host: Rabbit
Target Name: UMPS
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml |
|
| Image 6 | Human Bronchial Epithelial Tissue
 | Rabbit Anti-UMPS Antibody
Catalog Number: ARP48147_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
|
|
